Loren Data's SAM Daily™

fbodaily.com
Home Today's SAM Search Archives Numbered Notes CBD Archives Subscribe
FBO DAILY - FEDBIZOPPS ISSUE OF MAY 02, 2014 FBO #4542
MODIFICATION

99 -- Peptide Synthesis

Notice Date
4/30/2014
 
Notice Type
Modification/Amendment
 
NAICS
541990 — All Other Professional, Scientific, and Technical Services
 
Contracting Office
Department of Health and Human Services, National Institutes of Health, National Institute of Allergy & Infectious Diseases/AMOB, 10401 Fernwood Drive, Suite 2NE70, MSC 4811, Bethesda, Maryland, 20817
 
ZIP Code
20817
 
Solicitation Number
RML6-RFQ-14024
 
Archive Date
5/16/2014
 
Point of Contact
Michael S. Barrett, Phone: 4063759810, Julienne Keiser, Phone: 406-363-9370
 
E-Mail Address
michael.barrett@nih.gov, jkeiser@niaid.nih.gov
(michael.barrett@nih.gov, jkeiser@niaid.nih.gov)
 
Small Business Set-Aside
N/A
 
Description
This notice is a combined synopsis/solicitation for commercial items prepared in accordance with the format in FAR Subpart 12.6, as supplemented with additional information included in this notice. This announcement constitutes the only solicitation; quotes are being requested and a written solicitation will not be issued. This procurement is being issued as a request for quotation. Submit offers on RML6-RFQ-14024. The solicitation documents and incorporated provisions and clauses are those in effect through Federal Acquisition Circular 2005-72 dated Jan 30 th, 2014. This acquisition will be processed under Simplified Acquisition Procedures (SAP) and is not a Total Small Business Set-Aside. The North American Industry Classification System (NAICS) code for this procurement is 541990 and the small business size is $14,000,000.00. The National Institute of Allergy and infectious Diseases (NIAID) has a need for full length protein and peptide synthesis as listed below. Peptide Synthesis, 20mg at >70%: OVOC8995: 1 EACH MNAGSKHAFVMKIYRCKSQLAFLDTVILSVPTWGSMDEEVHGKEYLGLSTPCCVGTCVVECMHGNVPVP Peptide Synthesis: 20mg at >70%: 1 EACH CLSVPTWGSMDEEVHGKEY Peptide Synthesis, 20mg at >70%: OVOC12838: 1 EACH MLPGFLEYSLAGKALEKKIWNLEVVDIRFFAEDKHSTVDDVPYGGGAGMIMRPDVIGSAVDSVFSAHKNTRFIYMTPSGTKFNQ Peptide Synthesis: 20mg at >70%: 1 EACH CDSVFSAHKNTRFIYMTPSGTKFNQ 1 Peptide Synthesis: 20mg at >70%: 1 EACH CLEVVDIRFFAEDKHSTVDDVPY Peptide Conjugation to KLH 3 EACH Please include any applicable shipping and handling charges in your quotation. FOB Point shall be Destination, Bethesda, MD. Delivery location is National Institute of Health, Bethesda, MD 20892. The following FAR provisions and clauses apply to this acquisition: 52.212-1 Instructions to Offerors—Commercial Items (July 2013); FAR 52-212-4 Contract Terms and Conditions—Commercial Items (Nov 2013); FAR 52-212.5 Contract Terms and Conditions Required to Implement Statutes or Executive Orders(Nov 2013)—Commercial Items The following are clauses applicable to this acquisition incorporated by reference 52.219-4, 52.222-3, 52.222-19, 52.222-21, 52.222-26, 52.225-13, 52.232-33, 52.222-41; FAR 52.212-3 Offerors Representations and Certifications—Commercial Items. Warranty information to include period and coverage, shall be stated. In order to be considered for an award, offeror must have completed the Online Representations and Certifications located at http://www.sam.gov/ in accordance with FAR 4.1201(a). By submission of an offer, the offeror acknowledges the requirement that a prospective awardee shall be registered in the SAM database prior to award, during performance, and through final payment of any contract, basic agreement, basic ordering agreement, or blanket purchasing agreement resulting from this solicitation. Offers may be emailed to michael.barrett@nih.gov, at 903 South 4 th Street Hamilton, MT 59840, mailed or faxed to the POC indicated above (Fax - 406-363-9288). Offers must be submitted not later than 12:00 PM (MDST) 5/1/2014. Copies of the above-referenced clauses are available from http://www.acquisition.gov/far/loadmainre.html or upon request, either by telephone or fax. All responsible sources may submit an offer that will be considered by this Agency. Added: <input type="hidden" name="dnf_class_values[procurement_notice][description][1][added_on]" value="2014-04-28 11:30:10">Apr 28, 2014 11:30 am Modified: <input type="hidden" name="dnf_class_values[procurement_notice][description][1][modified_on]" value="2014-04-30 16:33:17">Apr 30, 2014 4:33 pm Track Changes This is in response to a few issues with the full length proteins not being completely viewable. This information will also be attached with a word document. Peptide Synthesis, 20mg at >70%: OVOC8995: 1 EACH MNAGSKHAFVMKIYRCKSQLAFLDTVILSVPTWGSMDEEVHGKEYLGLST PCCVGTCVVECMHGNVPVP Peptide Synthesis, 20mg at >70%: OVOC12838: 1 EACH MLPGFLEYSLAGKALEKKIWNLEVVDIRFFAEDKHSTVDDVPYGGGAGMI MRPDVIGSAVDSVFSAHKNTRFIYMTPSGTKFNQ Both of these full length peptides are not to be conjugated. The three small peptides are the only products needing conjugated. Furthermore, the least purity expected is 70% but the higher the purity the better. This is a onetime shipment and will not be an ongoing service or contain any sort of period of performance. Additionally, the soonest the peptides can be completed and shipped the better. We understand this is a significant undertaking and it may take a few weeks but we would like them by 5/31/2014. Please provide a quote even if you believe the end of May is unobtainable. Resonses will be accepted until 5/1/2014 at 12:00 PM MST
 
Web Link
FBO.gov Permalink
(https://www.fbo.gov/spg/HHS/NIH/AMOB/RML6-RFQ-14024/listing.html)
 
Place of Performance
Address: National Institute of Health, Bethesda, MD 20892, Bethesda, Maryland, 20892, United States
Zip Code: 20892
 
Record
SN03352245-W 20140502/140430234646-6712c49edb8a51baf9138785549dce17 (fbodaily.com)
 
Source
FedBizOpps Link to This Notice
(may not be valid after Archive Date)

FSG Index  |  This Issue's Index  |  Today's FBO Daily Index Page |
ECGrid: EDI VAN Interconnect ECGridOS: EDI Web Services Interconnect API Government Data Publications CBDDisk Subscribers
 Privacy Policy  Jenny in Wanderland!  © 1994-2026, Loren Data Corp.